PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013610460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 320aa    MW: 35911.4 Da    PI: 7.6852
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013610460.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.15.4e-201461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +l+ +v+q+G+++W++I++  g+ R++k+c++rw +yl
   XP_013610460.1 14 RGQWTPEEDNKLASYVAQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding45.71.6e-1468110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++ E+ ++v+ +  lG++ W++Ia+ ++ gRt++++k++w++
   XP_013610460.1  68 GQFSEAEEHIIVKFHSVLGNR-WSLIAAQLP-GRTDNDVKNYWNT 110
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129427.068965IPR017930Myb domain
SuperFamilySSF466891.39E-2911108IPR009057Homeodomain-like
SMARTSM007171.8E-141363IPR001005SANT/Myb domain
PfamPF002491.4E-181461IPR001005SANT/Myb domain
CDDcd001676.61E-121761No hitNo description
Gene3DG3DSA:1.10.10.609.6E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129419.99466116IPR017930Myb domain
SMARTSM007173.6E-1266114IPR001005SANT/Myb domain
PfamPF002495.7E-1368110IPR001005SANT/Myb domain
CDDcd001671.39E-870112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MGRIPCCEKE NVKRGQWTPE EDNKLASYVA QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGQF SEAEEHIIVK FHSVLGNRWS LIAAQLPGRT DNDVKNYWNT KLKKKLSGMG  120
IDPVTHKPFS HLMAEITTTL NPPQVSHLAE AALGCFKDEM LHLLTKKRVD LNQINFSNPN  180
PNNFNRTVDN EAGKMKMDGL ENGNGIMKLW DMGNGFSYGS SSSSFGNEDK NDGSASPAVA  240
VWRGQGGIRT AVAETAAAEE EERRKLKGEV VDQEENGSQG GRGDGMLMMR SQHDQHQHHV  300
FNVDNVLWDL QADDLINHVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6757050.0KM675705.1 Brassica oleracea MYB80 (MYB80) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610460.10.0PREDICTED: transcription factor MYB12
RefseqXP_013675070.10.0PREDICTED: transcription factor MYB12-like
RefseqXP_013680457.10.0PREDICTED: transcription factor MYB12-like
SwissprotQ9XHV00.0MYB80_ARATH; Transcription factor MYB80
TrEMBLA0A078J4390.0A0A078J439_BRANA; BnaCnng32030D protein
TrEMBLA0A0D3EBL60.0A0A0D3EBL6_BRAOL; Uncharacterized protein
STRINGBra002847.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM100052635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.10.0myb domain protein 103